ELISA Recombinant Oxyuranus microlepidotus Toxin 3FTx-Oxy6

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Others Uniprot ID: A7X4T2 Gene Names: N/A Organism: Oxyuranus microlepidotus (Inland taipan) AA Sequence: LKCHESENLDDHVVCEEDETMCYKFTFVPFRDFEIVARGCSASCPEEKDVVCCSTDLCNK Expression Region: 22-81aa Sequence Info: FµLl Length of Mature Protein Source: E.coli Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged MW: 26.9 kDa Alternative Name(s): Relevance: Reference: "Evolution of an arsenal: structural and functional diversification of the venom system in the advanced snakes (Caenophidia)." Fry B.G., Scheib H., van der Weerd L., Young B., McNaµghtan J., Ramjan S.F.R., Vidal N., Poelmann R.E., Norman J.A. Mol. Cell. Proteomics 7:215-246(2008) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.