ELISA Recombinant Oxyuranus microlepidotus Toxin 3FTx-Oxy6
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: A7X4T2
Gene Names: N/A
Organism: Oxyuranus microlepidotus (Inland taipan)
AA Sequence: LKCHESENLDDHVVCEEDETMCYKFTFVPFRDFEIVARGCSASCPEEKDVVCCSTDLCNK
Expression Region: 22-81aa
Sequence Info: FµLl Length of Mature Protein
Source: E.coli
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
MW: 26.9 kDa
Alternative Name(s):
Relevance:
Reference: "Evolution of an arsenal: structural and functional diversification of the venom system in the advanced snakes (Caenophidia)." Fry B.G., Scheib H., van der Weerd L., Young B., McNaµghtan J., Ramjan S.F.R., Vidal N., Poelmann R.E., Norman J.A. Mol. Cell. Proteomics 7:215-246(2008)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
This content will be shared across all product pages.
Internal Reference:
CSB-EP415963OGE
Website URL:
/shop/csb-ep415963oge-elisa-recombinant-oxyuranus-microlepidotus-toxin-3ftx-oxy6-148688