ELISA Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 12(PCR12)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9SX26
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MYGNGPVFKAEGTSFRDQPYAEQLPQGLWTTGLCDCHEDAHICVQTAIMPCVSFAQNVEI VNRGTIPCMNAGLIHLALGFIGCSWLYAFPNRSRLREHFALPEEPCRDFLVHLFCTPCAI CQESRELKNRGADPSIGWLSNVEKWSREKVTPPIVVPGMIR
Protein Names:Recommended name: Protein PLANT CADMIUM RESISTANCE 12 Short name= AtPCR12
Gene Names:Name:PCR12 Ordered Locus Names:At1g68630 ORF Names:F24J5.13
Expression Region:1-161
Sequence Info:fµLl length protein
This kit is an essential tool for professionals seeking to conduct detailed analyses of neurotransmitter levels in urine, aiding in the understanding and management of various neurological and psychiatric conditions.
Internal Reference:
CSB-CF890464DOA
Website URL:
/shop/csb-cf890464doa-elisa-recombinant-arabidopsis-thaliana-protein-plant-cadmium-resistance-12-pcr12-117041
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.