Skip to Content

ELISA Recombinant Streptomyces coelicolor ATP synthase subunit b(atpF)

https://www.e-scapebio.com/web/image/product.template/159137/image_1920?unique=b3f4f0f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) Uniprot NO.:Q9K4D7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSPmLQIAAEEMENPLIPPIPELVIGLIAFVIVFGFLAKKLLPNINKVLEERREAIEGGI EKAEAAQTEAQSVLEQYKAQLAEARHEAARLRQEAQEQGATLIAEMRAEGQRQREEIIAA GHAQIQADRKAAASALRQDVGKLATELAGKLVGESLEDHARQSRVIDRFLDELDDKATTA EATR Protein Names:Recommended name: ATP synthase subunit b Alternative name(s): ATP synthase F(0) sector subunit b ATPase subunit I F-type ATPase subunit b Short name= F-ATPase subunit b Gene Names:Name:atpF Ordered Locus Names:SCO5369 ORF Names:2SC6G5.13 Expression Region:1-184 Sequence Info:fµLl length protein

1,529.00 € 1529.0 EUR 1,529.00 € Tax Excluded

1,529.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This kit is an essential tool for professionals seeking to conduct detailed analyses of neurotransmitter levels in urine, aiding in the understanding and management of various neurological and psychiatric conditions.

 
Terms and Conditions

30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF881465FOB
Website URL: /shop/csb-cf881465fob-elisa-recombinant-streptomyces-coelicolor-atp-synthase-subunit-b-atpf-159137



Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.