ELISA Recombinant Streptomyces coelicolor ATP synthase subunit b(atpF)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Uniprot NO.:Q9K4D7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSPmLQIAAEEMENPLIPPIPELVIGLIAFVIVFGFLAKKLLPNINKVLEERREAIEGGI EKAEAAQTEAQSVLEQYKAQLAEARHEAARLRQEAQEQGATLIAEMRAEGQRQREEIIAA GHAQIQADRKAAASALRQDVGKLATELAGKLVGESLEDHARQSRVIDRFLDELDDKATTA EATR
Protein Names:Recommended name: ATP synthase subunit b Alternative name(s): ATP synthase F(0) sector subunit b ATPase subunit I F-type ATPase subunit b Short name= F-ATPase subunit b
Gene Names:Name:atpF Ordered Locus Names:SCO5369 ORF Names:2SC6G5.13
Expression Region:1-184
Sequence Info:fµLl length protein
This kit is an essential tool for professionals seeking to conduct detailed analyses of neurotransmitter levels in urine, aiding in the understanding and management of various neurological and psychiatric conditions.
Internal Reference:
CSB-CF881465FOB
Website URL:
/shop/csb-cf881465fob-elisa-recombinant-streptomyces-coelicolor-atp-synthase-subunit-b-atpf-159137
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.