ELISA Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 4(PCR4)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9LS44
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGRPGSQPNEAQPPPVQVQPTVNRDNQVHSQNGAIGQANIQTGRPVNNQTQNLWSSDLFD CMNDSENAVITCLAPCVTLGQIAEIVDEGATPCATGGLLYGMIFFIGVPFVYSCMFRAKM RNKYGLPDAPAPDWITHLFCEHCALCQEYRELKHRGFDPNIGWAGNVQAQQPVMSPPTGQ RMMG
Protein Names:Recommended name: Protein PLANT CADMIUM RESISTANCE 4 Short name= AtPCR4
Gene Names:Name:PCR4 Ordered Locus Names:At3g18460 ORF Names:MYF24.18
Expression Region:1-184
Sequence Info:fµLl length protein
This kit is an essential tool for professionals seeking to conduct detailed analyses of neurotransmitter levels in urine, aiding in the understanding and management of various neurological and psychiatric conditions.
Internal Reference:
CSB-CF864825DOA
Website URL:
/shop/csb-cf864825doa-elisa-recombinant-arabidopsis-thaliana-protein-plant-cadmium-resistance-4-pcr4-117044
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.