ELISA Recombinant Putative G-protein coupled receptor GPCR39
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Homo sapiens ()
Uniprot NO.:Q8NGA4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNGVSEGTRGCSDRQPGALTQGHSCSRKMNASRCLSEEVGSLRPLTMAVLSASFVVGVLG NGLVPWVTVFRMARTVSTVCFFHLALADFmLSLSLPILVYYIVSRQWLLGEWACKLYTGF VFLTFSTSNCLLVLISVDRCISVLYPVWALNHRTEQRASWLAFGVWLLAAALCSAHLKFR TTRKWNGCMQCYLQFNLENETAQMWTQEVFGRQMAVIMAHFLLGFLGPLAIIGTCAHLIR AKLLREGWVHANRPKRLLLVLVSALSAGSHLT
Protein Names:Recommended name: Putative G-protein coupled receptor GPCR39 Short name= hGPCR39
Gene Names:
Expression Region:1-272
Sequence Info:fµLl length protein
This kit is an essential tool for professionals seeking to conduct detailed analyses of neurotransmitter levels in urine, aiding in the understanding and management of various neurological and psychiatric conditions.
Internal Reference:
CSB-CF850885HU
Website URL:
/shop/csb-cf850885hu-elisa-recombinant-putative-g-protein-coupled-receptor-gpcr39-137900
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.