ELISA Recombinant Calycanthus floridus var. glaucus Photosystem II reaction center protein H(psbH)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Calycanthus floridus var. glaucus (Eastern sweetshrub) (Calycanthus fertilis var. ferax) Uniprot NO.:Q7YJU9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ATQTVEGSSRSGPRRTLTGDLLKPLNSEYGKVAPGWGTTPFMGVAMALFAIFLSIILEIY NSSVLLDGISTS Protein Names:Recommended name: Photosystem II reaction center protein H Short name= PSII-H Alternative name(s): Photosystem II 10 kDa phosphoprotein Gene Names:Name:psbH Expression Region:2-73 Sequence Info:fµLl length protein