Skip to Content

ELISA Recombinant Candida glabrata ATP synthase subunit 9, mitochondrial(ATP9)

https://www.e-scapebio.com/web/image/product.template/121430/image_1920?unique=7485b17
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (TorµLopsis glabrata) Uniprot NO.:Q85Q98 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQLALAAKYIGAGISTIGLIGAGIGIGIVFAALINGVSRNPSLKDTLFSYSILGMALSEA TGLFCLMISFmLLFAV Protein Names:Recommended name: ATP synthase subunit 9, mitochondrial Alternative name(s): Lipid-binding protein Gene Names:Name:ATP9 Expression Region:1-76 Sequence Info:fµLl length protein

1,415.00 € 1415.0 EUR 1,415.00 € Tax Excluded

1,415.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This kit is an essential tool for professionals seeking to conduct detailed analyses of neurotransmitter levels in urine, aiding in the understanding and management of various neurological and psychiatric conditions.

 
Terms and Conditions

30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF771232CZI
Website URL: /shop/csb-cf771232czi-elisa-recombinant-candida-glabrata-atp-synthase-subunit-9-mitochondrial-atp9-121430



Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.