ELISA Recombinant Candida glabrata ATP synthase subunit 9, mitochondrial(ATP9)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (TorµLopsis glabrata)
Uniprot NO.:Q85Q98
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQLALAAKYIGAGISTIGLIGAGIGIGIVFAALINGVSRNPSLKDTLFSYSILGMALSEA TGLFCLMISFmLLFAV
Protein Names:Recommended name: ATP synthase subunit 9, mitochondrial Alternative name(s): Lipid-binding protein
Gene Names:Name:ATP9
Expression Region:1-76
Sequence Info:fµLl length protein
This kit is an essential tool for professionals seeking to conduct detailed analyses of neurotransmitter levels in urine, aiding in the understanding and management of various neurological and psychiatric conditions.
Internal Reference:
CSB-CF771232CZI
Website URL:
/shop/csb-cf771232czi-elisa-recombinant-candida-glabrata-atp-synthase-subunit-9-mitochondrial-atp9-121430
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.