Skip to Content

ELISA Recombinant Huperzia lucidula Photosystem II reaction center protein H(psbH)

https://www.e-scapebio.com/web/image/product.template/140969/image_1920?unique=4552294
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Huperzia lucidµLa (Shining clubmoss) (Lycopodium lucidµLum) Uniprot NO.:Q5SD22 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ATQISDISRRTKVKSTGLGNALKPLNSEYGKVAPGWGTTPIMGVAMASFAVFSVIILELY NSSVSLDGIPVSW Protein Names:Recommended name: Photosystem II reaction center protein H Short name= PSII-H Alternative name(s): Photosystem II 10 kDa phosphoprotein Gene Names:Name:psbH Expression Region:2-74 Sequence Info:fµLl length protein

1,412.00 € 1412.0 EUR 1,412.00 € Tax Excluded

1,412.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This kit is an essential tool for professionals seeking to conduct detailed analyses of neurotransmitter levels in urine, aiding in the understanding and management of various neurological and psychiatric conditions.

 
Terms and Conditions

30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF725508HCAC
Website URL: /shop/csb-cf725508hcac-elisa-recombinant-huperzia-lucidula-photosystem-ii-reaction-center-protein-h-psbh-140969



Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.