ELISA Recombinant Bacillus licheniformis Spore morphogenesis and germination protein ywcE(ywcE)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bacillus licheniformis (strain DSM 13 / ATCC 14580) Uniprot NO.:Q65DM3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDMFFAYLLIASATPLFLWLDNKKVAISSIPPIILMWVFFFFYMTSSLSPTGHSLMIALF ILNVVIAHVAAFIIYGLPLIRKHMSR Protein Names:Recommended name: Spore morphogenesis and germination protein ywcE Gene Names:Name:ywcE Ordered Locus Names:BLi04028, BL02804 Expression Region:1-86 Sequence Info:fµLl length protein