ELISA Recombinant Psychrobacter cryohalolentis UPF0060 membrane protein Pcryo_1498(Pcryo_1498)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Psychrobacter cryohalolentis (strain K5)
Uniprot NO.:Q1QAM6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSELKTVGLFALTALAEIAGCYLPYLWLREGKSVWLLIPGALSLIAFVWLLSLHPTAAGR VYAAYGGVYISMVILWLWTVNGIRPTTWDIVGSAIALLGMAIIMFAPRSA
Protein Names:Recommended name: UPF0060 membrane protein Pcryo_1498
Gene Names:Ordered Locus Names:Pcryo_1498
Expression Region:1-110
Sequence Info:fµLl length protein
This content will be shared across all product pages.
Internal Reference:
CSB-CF630961PAAM
Website URL:
/shop/csb-cf630961paam-elisa-recombinant-psychrobacter-cryohalolentis-upf0060-membrane-protein-pcryo-1498-pcryo-1498-151380