Skip to Content

ELISA Recombinant Psychrobacter cryohalolentis UPF0059 membrane protein Pcryo_1339(Pcryo_1339)

https://www.e-scapebio.com/web/image/product.template/151378/image_1920?unique=a9584cd
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Psychrobacter cryohalolentis (strain K5) Uniprot NO.:Q1QB33 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLEVLLLALALAADAFAASIGLGSTHKSDVNSQFMKMALLIGVYFGVAQGVMPLIGYALG STmLGWFAEGASWVAFVILVALGIKmLYESRSVNNDETRINLSHKTLLSLAIATSLDAMG AGFTLNLLAVNAYLACLIIALTTAVLSVLGAYIGRKSGTWLGSWAEALGGLVLIAIGVNM VV Protein Names:Recommended name: UPF0059 membrane protein Pcryo_1339 Gene Names:Ordered Locus Names:Pcryo_1339 Expression Region:1-182 Sequence Info:fµLl length protein

1,527.00 € 1527.0 EUR 1,527.00 € Tax Excluded

1,527.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This kit is an essential tool for professionals seeking to conduct detailed analyses of neurotransmitter levels in urine, aiding in the understanding and management of various neurological and psychiatric conditions.

 
Terms and Conditions

30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF629920PAAM
Website URL: /shop/csb-cf629920paam-elisa-recombinant-psychrobacter-cryohalolentis-upf0059-membrane-protein-pcryo-1339-pcryo-1339-151378



Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.