ELISA Recombinant Trichodesmium erythraeum Cytochrome b559 subunit alpha(psbE)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Trichodesmium erythraeum (strain IMS101) Uniprot NO.:Q10YT0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAGGSTGERPFGDIITSIRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPNEYYTEQ RQELPILSDRFESKQQIDDFIK Protein Names:Recommended name: Cytochrome b559 subunit alpha Alternative name(s): PSII reaction center subunit V Gene Names:Name:psbE Ordered Locus Names:Tery_3504 Expression Region:1-82 Sequence Info:fµLl length protein