Skip to Content

ELISA Recombinant Microcystis aeruginosa NAD(P)H-quinone oxidoreductase subunit L

https://www.e-scapebio.com/web/image/product.template/143442/image_1920?unique=2109108
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Microcystis aerµginosa (strain NIES-843) Uniprot NO.:B0JWY5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQSILTQETIIIALIYLSLSVLYLLVIPAVIYYYLNTRWYVASSWERGFMYFLMSFFFPG mLLLSPFLNFRPQRRTLKA Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit L EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase I subunit L NDH-1 subunit L NDH-L Gene Names:Name:ndhL Ordered Locus Names:MAE_50500 Expression Region:1-79 Sequence Info:fµLl length protein

1,418.00 € 1418.0 EUR 1,418.00 € Tax Excluded

1,418.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This kit is an essential tool for professionals seeking to conduct detailed analyses of neurotransmitter levels in urine, aiding in the understanding and management of various neurological and psychiatric conditions.

 
Terms and Conditions

30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF539644MTQ
Website URL: /shop/csb-cf539644mtq-elisa-recombinant-microcystis-aeruginosa-nad-p-h-quinone-oxidoreductase-subunit-l-143442



Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.