?unique=7f7b80c)
ELISA Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1482 (AF_1482)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Archaeoglobus fµLgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Uniprot NO.:O28790
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDTSELERRAKICLSVVTFSTSYSLDAGVVVLAFLGIQRFRRSSKGAKIPEFLWVTWQSF IKVLSLLNGFVQHQKRYIFIRVCIY
Protein Names:Recommended name: Uncharacterized protein AF_1482
Gene Names:Ordered Locus Names:AF_1482
Expression Region:1-85
Sequence Info:fµLl length protein
This kit is an essential tool for professionals seeking to conduct detailed analyses of neurotransmitter levels in urine, aiding in the understanding and management of various neurological and psychiatric conditions.
Internal Reference:
CSB-CF518078DOC
Website URL:
/shop/csb-cf518078doc-elisa-recombinant-archaeoglobus-fulgidus-uncharacterized-protein-af-1482-af-1482-117473
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.