ELISA Recombinant Uncharacterized membrane protein yhzF(yhzF)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bacillus subtilis Uniprot NO.:C0H3Y3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSVFLIVLSCITLAFASGAVYYIKLLSQAASYPPKRVIRQKALVCSTGTAFTLCLIFFTK LLA Protein Names:Recommended name: Uncharacterized membrane protein yhzF Gene Names:Name:yhzF Ordered Locus Names:BSU10009 Expression Region:1-63 Sequence Info:fµLl length protein