ELISA Recombinant Escherichia coli O8 Protein AaeX(aaeX)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli O8 (strain IAI1)
Uniprot NO.:B7M0V4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV
Protein Names:Recommended name: Protein AaeX
Gene Names:Name:aaeX Ordered Locus Names:ECIAI1_3384
Expression Region:1-67
Sequence Info:fµLl length protein
This kit is an essential tool for professionals seeking to conduct detailed analyses of neurotransmitter levels in urine, aiding in the understanding and management of various neurological and psychiatric conditions.
Internal Reference:
CSB-CF485962EOO
Website URL:
/shop/csb-cf485962eoo-elisa-recombinant-escherichia-coli-o8-protein-aaex-aaex-127069
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.