ELISA Recombinant Cuscuta obtusiflora ATP synthase subunit C, plastid(atpE)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Cuscuta obtusiflora (Peruvian dodder) Uniprot NO.:A8W3H7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNPIISAASVIAAGFAVGLASIGPGIGQGTAAGRAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFI Protein Names:Recommended name: ATP synthase subunit C, plastid Alternative name(s): ATP synthase F0 sector subunit C ATPase subunit III Lipid-binding protein Gene Names:Name:atpE Synonyms:atpH Expression Region:1-81 Sequence Info:fµLl length protein