ELISA Recombinant Leptosira terrestris ATP synthase subunit c, chloroplastic(atpH)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Leptosira terrestris (Filamentous green alga) (Pleurastrum terrestre)
Uniprot NO.:A6YG66
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNPLVAATSVIAAGLAVGLAAIGPGIGQGTAAGYAVEGIARQPEAEGKIRGALLLSFAFM ESLTIYGLVVALALLFANPFVS
Protein Names:Recommended name: ATP synthase subunit c, chloroplastic Alternative name(s): ATP synthase F(0) sector subunit c ATPase subunit III F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein
Gene Names:Name:atpH
Expression Region:1-82
Sequence Info:fµLl length protein
This kit is an essential tool for professionals seeking to conduct detailed analyses of neurotransmitter levels in urine, aiding in the understanding and management of various neurological and psychiatric conditions.
Internal Reference:
CSB-CF413080LLQ
Website URL:
/shop/csb-cf413080llq-elisa-recombinant-leptosira-terrestris-atp-synthase-subunit-c-chloroplastic-atph-141964
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.