ELISA Recombinant Thalassiosira pseudonana ATP synthase subunit c, chloroplastic(atpH)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Thalassiosira pseudonana (Marine diatom) (Cyclotella nana) Uniprot NO.:A0T0P0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDSIISAASVIAAGLAIGLAAIGPGIGQGNAAGQAVEGIARQPEAENKIRGTLLLSLAFM EALTIYGLVVALALLFANPFNS Protein Names:Recommended name: ATP synthase subunit c, chloroplastic Alternative name(s): ATP synthase F(0) sector subunit c ATPase subunit III F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein Gene Names:Name:atpH Expression Region:1-82 Sequence Info:fµLl length protein