ELISA Recombinant Spiroplasma virus SpV1-R8A2 B Uncharacterized protein ORF10 (ORF10)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Spiroplasma virus SpV1-R8A2 B (SpV1) (Spiroplasma virus 1) Uniprot NO.:P15901 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQNDWIKLKEFFIYIFLFIDKTNVESITMWNLTQNEYLTLMVGVWIVILFLTWFLLWMVF KIVGYFK Protein Names:Recommended name: Uncharacterized protein ORF10 Alternative name(s): Gene 10 protein Gene Names:ORF Names:ORF10 Expression Region:1-67 Sequence Info:fµLl length protein