ELISA Recombinant Mouse Tumor necrosis factor receptor superfamily member 9(Tnfrsf9)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Mus muscµLus (Mouse) Uniprot NO.:P20334 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLTLFLALTSALLLALIFITLLFSVLKWIRKKFPHIFKQPFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL Protein Names:Recommended name: Tumor necrosis factor receptor superfamily member 9 Alternative name(s): 4-1BB ligand receptor T-cell antigen 4-1BB CD_antigen= CD137 Gene Names:Name:Tnfrsf9 Synonyms:Cd137, Ila, Ly63 Expression Region:24-256 Sequence Info:fµLl length protein