ELISA Recombinant Donkey NADH-ubiquinone oxidoreductase chain 4L(MT-ND4L)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Equus asinus (Donkey) Uniprot NO.:P92483 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSLAHINIFLAFTVSLVGLLMYRSHLMSSLLCLEGMmLSLFVMATMVVLNTHFTLASMMP IILLVFAACERALGLSLLVMVSNTYGVDHVQNLNLLQC Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 4L EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 4L Gene Names:Name:MT-ND4L Synonyms:MTND4L, NADH4L, ND4L Expression Region:1-98 Sequence Info:FµLl length protein